PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TCP
Protein Properties Length: 257aa    MW: 27866.2 Da    PI: 8.3657
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087116.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.34e-3649133286
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                     a+k+++++++h kv+gR+RR+R++a+caar+F+L++eLG+ +d++ti+WLlqqa+p+i+++tgt++++as++ a++ s+s++ +s
  XP_011087116.1  49 APKRRSNKDRHKKVDGRGRRIRIPALCAARIFQLTRELGHRTDGETIQWLLQQAEPSIIAATGTGTIPASAVIAAEASVSGQGDS 133
                     789******************************************************************9996666666666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-2954187IPR005333Transcription factor, TCP
PROSITE profilePS5136926.59155109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MPHFSGLLME HKPSKHQQQL QISQGHVPHP DMALNKPQQL DDNKKRQLAP KRRSNKDRHK  60
KVDGRGRRIR IPALCAARIF QLTRELGHRT DGETIQWLLQ QAEPSIIAAT GTGTIPASAV  120
IAAEASVSGQ GDSVTCGLYS RLIGEDVLGR SMGIWPCLNG FGSGILQNPS DLGSNQTGNR  180
VGKIGFQGFE FPGSGSFGQH GPGLELGLSQ EGQVGGMNLE ALSQFYQQMR QQNGECSGLS  240
SHQEQNHGEE NSQGSRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087116.10.0PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD56e-57TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A068UY752e-80A0A068UY75_COFCA; Uncharacterized protein
STRINGVIT_14s0068g01690.t014e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-57TCP family protein